BAIAP3 Polyclonal antibody

• 

  WB analysis of mouse brain using 24836-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24836-1-AP (BAIAP3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 24836-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24836-1-AP (BAIAP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 24836-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24836-1-AP (BAIAP3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 24836-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using BAIAP3 antibody (24836-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

BAIAP3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24836-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

BAI1 associated protein 3, BAI1-associated protein 3, BAP3, KIAA0734

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

24836-1-AP targets BAIAP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21219

  Product name: Recombinant human BAIAP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1056-1187 aa of BC104966

  Sequence: PPHLFPLVRSQRTQVKTRTLHPVYDELFYFSVPAEACRRRAACVLFTVMDHDWLSTNDFAGEAALGLGGVTGVARPQVGGGARAGQPVTLHLCRPRAQVRSALRRLEGRTSKEAQEFVKKLKELEKCMEADP

• Full Name: BAI1-associated protein 3
• Calculated Molecular Weight: 1187 aa, 132 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC104966
• Gene Symbol: BAIAP3
• Gene ID (NCBI): 8938
• RRID: AB_2879751
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94812
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Bai1 associated protein 3 (BAIAP3) is also named as BAP3 and KIAA0734, and belongs to the unc-13 family. It has the function of retrograde transport of endosomes to the Golgi apparatus. BAIAP3 may regulate behavior and food intake by controlling calcium-stimulated exocytosis of neurotransmitters including NPY and serotonin and hormones like insulin (PMID:286260000).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Aging (Albany NY); Integrated analysis of microRNA and mRNA expression profiling identifies BAIAP3 as a novel target of dysregulated hsa-miR-1972 in age-related white matter lesions.; Authors - Wen-Qing Huang
human	WB	J Affect Disord; Label-free proteomics differences in the dorsolateral prefrontal cortex between bipolar disorder patients with and without psychosis.; Authors - Ada M-C Ho