BAP1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 83371-1-RR (same clone as 83371-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83371-1-RR (BAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83371-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00357-1

  Cytometric bead array standard curve of MP00357-1, BAP1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83371-1-PBS. Detection antibody: 83371-2-PBS. Standard: Ag34415. Range: 1.25-80 ng/mL.

• 

  Affinity and Kinetic Characterization of 83371-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 83371-1-PBS against Human BAP1 was performed. The affinity constant is below 1 pM.

• 

  Affinity and Kinetic Characterization of 83371-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83371-1-RR against Human BAP1 were performed. The affinity constant is below 1 pM.

BAP1 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83371-1-PBS

Clone No.240349A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

hucep 6, HUCEP 13, EC:3.4.19.12, Cerebral protein 6, BRCA1-associated protein 1

---

Product Information

83371-1-PBS targets BAP1 as part of a matched antibody pair:

MP00357-1: 83371-1-PBS capture and 83371-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34415

  Product name: Recombinant human BAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 575-729 aa of BC001596

  Sequence: LTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ

• Full Name: BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
• Calculated Molecular Weight: 81-91 kDa
• GenBank Accession Number: BC001596
• Gene Symbol: BAP1
• Gene ID (NCBI): 8314
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92560
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.