BARX1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BARX1 Polyclonal antibody (27281-1-AP)

BARX1 Polyclonal Antibody for WB, ELISA

Cat No. 27281-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

BARX homeobox 1, BARX1, Homeobox protein BarH like 1

• 

  WB analysis of mouse heart using 27281-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 27281-1-AP (BARX1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BARX1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27281-1-AP targets BARX1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25833

  Product name: Recombinant human BARX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-144 aa of BC064363

  Sequence: MQRPGEPGAARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLSSALLAAGPGLPGAAGAPHLPLELQLRGKLEAAGPGEPGTKAKKGRR

• Full Name: BARX homeobox 1
• GenBank Accession Number: BC064363
• Gene Symbol: BARX1
• Gene ID (NCBI): 56033
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBU1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The BARX1 Polyclonal antibody (Cat# 27281-1-AP) has 2 citations. One appears in Dose Response (2022), studying the protective effects of apigenin against radiation-induced intestinal injury in mice using WB. The other is in Mater Today Bio (2026), investigating a zinc organic metal skeleton vaccine for lung cancer treatment that stimulates innate and adaptive anti-tumor immunity. The associated research fields span radiation biology/gastroenterology and oncology/immunotherapy.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Dose Response; The Protective Effects of Apigenin Against Radiation-Induced Intestinal Injury.; Authors - Danjie Liu
		Mater Today Bio; A zinc organic metal skeleton vaccine for lung cancer treatment can stimulate strong innate and adaptive anti-tumor immunity.; Authors - Xuejian Liu