BAT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BAT1 Polyclonal antibody (14798-1-AP)

• Featured Product
• KD/KO Validated

BAT1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14798-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, IP, CoIP, ChIP, RIP, ELISA

Synonyms

DDX39B, UAP56, 56 kDa U2AF65-associated protein, ATP-dependent RNA helicase p47, D6S81E

• 

  WB analysis of Jurkat using 14798-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14798-1-AP (BAT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 14798-1-AP

  WB result of BAT1 antibody (14798-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BAT1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat spleen using 14798-1-AP

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 14798-1-AP (BAT1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 14798-1-AP

  IP result of anti-BAT1 (IP:14798-1-AP, 4ug; Detection:14798-1-AP 1:500) with Jurkat cells lysate 1200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 14798-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14798-1-AP (BAT1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 14798-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14798-1-AP (BAT1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BAT1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, rat spleen tissue
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14798-1-AP targets BAT1 in WB, IHC, IF, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6512

  Product name: Recombinant human BAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 80-428 aa of BC000361

  Sequence: ILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR

• Full Name: HLA-B associated transcript 1
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000361
• Gene Symbol: BAT1
• Gene ID (NCBI): 7919
• RRID: AB_2061854
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13838
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAT1, is a 428 amino acid protein, which contains one helicase C-terminal domain, one helicase ATP-binding domain and belongs to the DEAD box helicase family. DECD subfamily. DDX39B localizes in the nucleus and cytoplasm. BAT1 is involved in nuclear export of spliced and unspliced mRNA. BAT1 as ATP dependent RNA helicase, may be a translation initiation factor and acts as a negative regulator of inflammatory cytokines. This antibody may cross-react with DDX39A.

Publications

What published studies show

The DDX39B antibody (Cat# 14798-1-AP) has 18 total citations published in journals including Nature, Cell, Cell Metabolism, Molecular Cell, Genes & Development, Cell Death & Disease, Redox Biology, PLoS Pathogens, and iScience. Associated research fields encompass RNA nuclear export, nucleolar biology, cancer (breast, colorectal, pancreatic, hepatocellular carcinoma), viral infection, RNA helicase function, alternative splicing, ferroptosis, ALS, and early embryogenesis.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Nuclear export of circular RNA; Authors - Linh H Ngo
mouse	IF	Cell; Nuclear envelope budding enables export of large transcripts in muscle cells.; Authors - Sofia Zaganelli
human	WB	Cell Metab; NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis.; Authors - Mi Kyung Park
human	IF	Redox Biol; Reduced dynamicity and increased high-order protein assemblies in dense fibrillar component of the nucleolus under cellular senescence; Authors - Minjeong Jo
human	WB,IF	Mol Cell; 1The RNA helicase DDX39A binds a conserved structure in chikungunya virus RNA to control infection; Authors - Iulia Tapescu ; KD Validated
human	WB,IF	J Exp Clin Cancer Res; RETSAT associates with DDX39B to promote fork restarting and resistance to gemcitabine based chemotherapy in pancreatic ductal adenocarcinoma; Authors - Qiu Tu ; KD Validated