PRRC2C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PRRC2C Polyclonal antibody (31383-1-AP)

PRRC2C Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 31383-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

BAT2D1, BAT2 iso, BAT2L2, KIAA1096, XTP2

• 

  WB analysis using 31383-1-AP

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 31383-1-AP (BAT2D1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 31383-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31383-1-AP (PRRC2C antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 31383-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 31383-1-AP (PRRC2C antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 31383-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 31383-1-AP (PRRC2C antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat stomach using 31383-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 31383-1-AP (PRRC2C antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 31383-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 31383-1-AP (PRRC2C antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 31383-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using PRRC2C antibody (31383-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, K-562 cells, PC-3 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31383-1-AP targets PRRC2C in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35409

  Product name: Recombinant human BAT2D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 881-1050 aa of BC006090

  Sequence: DVRPHHTDANNQSACFEAPDQKTLSAPQEERISAVESQPSRKRSVSHGSNHTQKPDEQRSEPSAGIPKVTSRCIDSKEPIERPEEKPKKEGFIRSSEGPKPEKVYKSKSETRWGPRPSSNRREEVNDRPVRRSGPIKKPVLRDMKEEREQRKEKEGEKAEKVTEKVVVKP

• Full Name: BAT2 domain containing 1
• Observed Molecular Weight: 450 kDa
• GenBank Accession Number: BC006090
• Gene Symbol: BAT2D1
• Gene ID (NCBI): 23215
• RRID: AB_3742423
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y520
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRRC2C encodes a RNA-binding protein that participates in stress granule assembly and is found in the cytosol and cytoplasm. The protein is also detected in cytoplasmic stress granules and membranes, placing it in compartments associated with dynamic post-transcriptional regulation. Expression measurements show particularly high levels in brain, respiratory system, and proximal digestive tract, supporting a role in tissues with active RNA regulatory demands.