BAT5 Polyclonal antibody

• 

  WB analysis using 17317-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17317-1-AP (BAT5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 17317-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17317-1-AP (BAT5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 17317-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17317-1-AP (BAT5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

BAT5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17317-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ABHD16A, Alpha/beta hydrolase domain-containing protein 16A, EC:3.1.-.-, EC:3.1.1.23, G5

---

Tested Applications

• Positive WB detected in: human placenta tissue, mouse cerebellum tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17317-1-AP targets BAT5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11287

  Product name: Recombinant human BAT5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 209-558 aa of BC031839

  Sequence: SYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFTATWAAMSYPDVSAMILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIMSNRGNDLLLKLLQHRYPRVMAEEGLRVVRQWLEASSQLEEASIYSRWEVEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQNFQMPWHL

• Full Name: HLA-B associated transcript 5
• Calculated Molecular Weight: 558 aa, 63 kDa
• Observed Molecular Weight: 59~63 KdA
• GenBank Accession Number: BC031839
• Gene Symbol: BAT5
• Gene ID (NCBI): 7920
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95870
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human lymphocyte antigen B-associated transcript 5 (BAT5, also known as ABHD16A) is a 558 residue (63 kDa) protein encoded by 20 exons located on chromosome 6p21.33. BAT5 belongs to the α/β-hydrolase domain (ABHD) containing family of metabolic serine hydrolases and possesses both an esterase catalytic triad and an acyltransferase domain (PMID: 25290914). BAT5 not only participates in lipid metabolism but is also involved in the regulation of inflammation and immunity. BAT5 is predicted to be an integral membrane protein with highest mRNA transcript levels in mouse tissues found in testis, heart, muscle, and brain (PMID: 23328280).