BAX Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81789-4-RR (same clone as 81789-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81789-4-RR (BAX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81789-4-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 81789-4-RR (same clone as 81789-4-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using BAX antibody (81789-4-RR, Clone: 252648D5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 81789-4-PBS in a different storage buffer formulation.

• 

  Affinity of 81789-4-RR

  Biolayer interferometry (BLl) kinetic assays of 81789-4-RR against Human BAX were performed. The affinity constant is 0.85 nM.

BAX Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 81789-4-PBS

Clone No.252648D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Apoptosis regulator BAX, Bcl2-L-4, Bcl-2-like protein 4

---

Product Information

81789-4-PBS targets BAX in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag40421

  Product name: Recombinant human BAX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC014175

  Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGW

• Full Name: BCL2-associated X protein
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC014175
• Gene Symbol: BAX
• Gene ID (NCBI): 581
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07812
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BAX, also named as BCL2L4, is a pro-apoptotic member of the Bcl-2 protein family, which plays a pivotal role in controlling cell life and death. Bax largely localizes to the cytoplasm of healthy cells, but accumulates on the outer mitochondrial membrane upon apoptosis induction (PMID: 9108035). BAX can commit a cell to apoptosis by translocation from the cytosol to the mitochondria and permeabilization of the outer mitochondrial membrane, which leads to the release of cytochrome c from mitochondria (PMID: 21763611). The expression of BAX is upregulated by the tumor suppressor protein p53, and BAX has been shown to be involved in p53-mediated apoptosis (PMID: 8183579).