• Featured Product
  • KD/KO Validated

CoraLite®555-conjugated BAX Monoclonal antibody

BAX Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL555-60267
Clone No.4G5E8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

4G5E8, Apoptosis regulator BAX, Bcl2-L-4, Bcl-2-like protein 4

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-60267 targets BAX in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21068

Product name: Recombinant human BAX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-192 aa of BC014175

Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Predict reactive species
Full Name BCL2-associated X protein
Calculated Molecular Weight 21 kDa
GenBank Accession NumberBC014175
Gene Symbol BAX
Gene ID (NCBI) 581
RRIDAB_2919661
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ07812
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BAX, also named as BCL2L4, is a pro-apoptotic member of the Bcl-2 protein family, which plays a pivotal role in controlling cell life and death. Bax largely localizes to the cytoplasm of healthy cells, but accumulates on the outer mitochondrial membrane upon apoptosis induction (PMID: 9108035). BAX can commit a cell to apoptosis by translocation from the cytosol to the mitochondria and permeabilization of the outer mitochondrial membrane, which leads to the release of cytochrome c from mitochondria (PMID: 21763611). The expression of BAX is upregulated by the tumor suppressor protein p53, and BAX has been shown to be involved in p53-mediated apoptosis (PMID: 8183579).

Protocols

Product Specific Protocols
IF protocol for CL555 BAX antibody CL555-60267Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...