Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated BAX Monoclonal antibody

BAX Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-60267
Clone No. 4G5E8
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra)

Bcl-2-like protein 4, Bcl2-L-4, Apoptosis regulator BAX, 4G5E8

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for BAX in ?

Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60267 targets BAX in WB, IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityrat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21068

Product name: Recombinant human BAX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-192 aa of BC014175

Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Predict reactive species
Full Name BCL2-associated X protein
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC014175
Gene Symbol BAX
Gene ID (NCBI) 581
RRIDAB_2883130
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ07812
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BAX, also named as BCL2L4, is a pro-apoptotic member of the Bcl-2 protein family, which plays a pivotal role in controlling cell life and death. Bax largely localizes to the cytoplasm of healthy cells, but accumulates on the outer mitochondrial membrane upon apoptosis induction (PMID: 9108035). BAX can commit a cell to apoptosis by translocation from the cytosol to the mitochondria and permeabilization of the outer mitochondrial membrane, which leads to the release of cytochrome c from mitochondria (PMID: 21763611). The expression of BAX is upregulated by the tumor suppressor protein p53, and BAX has been shown to be involved in p53-mediated apoptosis (PMID: 8183579).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 BAX antibody CL488-60267Download protocol
IF protocol for CL Plus 488 BAX antibody CL488-60267Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The BAX Monoclonal antibody (4G5E8), catalog number CL488-60267 (CoraLite® Plus 488 conjugate), has 1 citation. It was published in Acta Biomaterialia (Impact Factor 10.4) in 2021. The study investigated a sodium alginate/collagen/SDF-1 neural scaffold loaded with bone marrow stromal cells for promoting neurological function recovery after traumatic brain injury in rats, using WB as the application. The research field encompasses biomaterials, neural tissue engineering, and traumatic brain injury.

SpeciesApplicationTitle
ratWB

Acta Biomater

Sodium alginate/collagen/stromal cell-derived factor-1 neural scaffold loaded with BMSCs promotes neurological function recovery after traumatic brain injury.

Authors - Shanshan Ma
Loading...
||
New chat

Able™

正在加载,请稍候...