BBOX1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BBOX1 Polyclonal antibody, PBS Only (16099-1-PBS)

• 

  WB analysis of human brain using 16099-1-AP (same clone as 16099-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 16099-1-AP (BBOX1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16099-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 16099-1-AP (same clone as 16099-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 16099-1-AP (BBOX1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16099-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16099-1-AP (same clone as 16099-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using BBOX1 antibody 16099-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 16099-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BBOX1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16099-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16099-1-PBS targets BBOX1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8964

  Product name: Recombinant human BBOX1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-387 aa of BC011034

  Sequence: MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN

• Full Name: butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1
• Calculated Molecular Weight: 387 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC011034
• Gene Symbol: BBOX1
• Gene ID (NCBI): 8424
• RRID: AB_2243498
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75936
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.