BBS3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BBS3 Polyclonal antibody, PBS Only (12676-1-PBS)

• 

  WB analysis of rat brain using 12676-1-AP (same clone as 12676-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 12676-1-AP (BBS3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12676-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 12676-1-AP (same clone as 12676-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12676-1-AP (BBS3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12676-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12676-1-AP (same clone as 12676-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12676-1-AP (BBS3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12676-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293T using 12676-1-AP (same clone as 12676-1-PBS)

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 12676-1-AP (BBS3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12676-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat brain using 12676-1-AP (same clone as 12676-1-PBS)

  IP result of anti-BBS3 (IP:12676-1-AP, 3ug; Detection:12676-1-AP 1:600) with rat brain tissue lysate 5200ug. This data was developed using the same antibody clone with 12676-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 12676-1-AP (same clone as 12676-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12676-1-AP (BBS3 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 12676-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 12676-1-AP (same clone as 12676-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12676-1-AP (BBS3 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 12676-1-PBS in a different storage buffer formulation.

• 

  IF Staining of hTERT-RPE1 cells using 12676-1-AP (same clone as 12676-1-PBS)

  IF result (cytoplasm and the base of cilia stain) of anti-BBS3 (12676-1-AP; 1:50) with hTERT-RPE1 cell (MeOH fixed) by Dr. Moshe Kim. This data was developed using the same antibody clone with 12676-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MDCK using 12676-1-AP (same clone as 12676-1-PBS)

  Immunofluorescent analysis of MDCK cells using 12676-1-AP (BBS3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12676-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BBS3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12676-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

12676-1-PBS targets BBS3 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, canine samples.

• Tested Reactivity: human, mouse, rat, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3363

  Product name: Recombinant human BBS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-186 aa of BC024239

  Sequence: MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT

• Full Name: ADP-ribosylation factor-like 6
• Calculated Molecular Weight: 186 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC024239
• Gene Symbol: ARL6/BBS3
• Gene ID (NCBI): 84100
• RRID: AB_2058675
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0F7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ADP-ribosylation factor-like protein 6 (ARL6), belongs to a small GTPase superfamily, is involved in membrane protein trafficking at the base of the ciliary organelle. ARL6 is also named Bardet-Biedl syndrome 3 protein, because defects in ARL6 are a cause of Bardet-Biedl syndrome type 3 (BBS3), which is a genetically heterogeneous disorder characterized by usually severe pigmentary retinopathy, early onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation. ARL6 can interact with many ARL6 interacting proteins and form BBSome complex with other BBS proteins including BBS1, BBS2, BBS4 and so on.