BCAM Polyclonal antibody

• 

  WB analysis using 28222-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28222-1-AP (BCAM antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

BCAM Polyclonal Antibody for WB, ELISA

Cat No. 28222-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

LU, F8/G253 antigen, CD239, B-CAM cell surface glycoprotein, Basal cell adhesion molecule

---

Tested Applications

• Positive WB detected in: A431 cells, HT-29 cells, human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28222-1-AP targets BCAM in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28181

  Product name: Recombinant human BCAM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-254 aa of BC050450

  Sequence: EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSP

• Full Name: basal cell adhesion molecule (Lutheran blood group)
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 67 kDa, 78-85 kDa
• GenBank Accession Number: BC050450
• Gene Symbol: BCAM
• Gene ID (NCBI): 4059
• RRID: AB_3086038
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50895
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Basal cell adhesion molecule (Lu/BCAM) is a membrane-bound glycoprotein of the immunoglobulin superfamily (IgSF), functioning as a receptor for the extracellular matrix protein, laminin. BCAM (Lutheran/basal cell-adhesion molecule, a glycoprotein) belongs to the immunoglobulin superfamily which contains both Lu blood group and BCAM tumor-associated antigens. Proteomics analysis suggests that BCAM might be a potential biomarker for pancreatic cancer (PMID: 19199705). BCAM, involved in cell adhesion and migration, can also promote tumor metastasis and has been elucidated to play a functional role in the metastasis of thyroid cancer and gastric cancer (PMID: 10728810, 35941663). De-glycosylated BCAM has a preidicted molecular weight of 67 kDa. Two BCAM glycoprotein (gp) isoforms are present on human RBCs, Lu (85 kDa) and Lu(v13) (78 kDa); they result from the alternative splicing of intron 13 and differ by the lengths of their cytoplasmic domains (PMID: 23160466).