BCAM Recombinant monoclonal antibody, PBS Only

• 

BCAM Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84038-2-PBS

Clone No.241051E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Auberger B antigen, Basal cell adhesion molecule, B-CAM cell surface glycoprotein, CD239, F8/G253 antigen

---

Product Information

84038-2-PBS targets BCAM in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28181

  Product name: Recombinant human BCAM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-254 aa of BC050450

  Sequence: EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSP

• Full Name: basal cell adhesion molecule (Lutheran blood group)
• Calculated Molecular Weight: 67 kDa
• GenBank Accession Number: BC050450
• Gene Symbol: BCAM
• Gene ID (NCBI): 4059
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P50895
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.