BCAM Recombinant monoclonal antibody, PBS Only

BCAM Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 84038-3-PBS
Clone No.241051C8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

241051C8, Auberger B antigen, Basal cell adhesion molecule, B-CAM cell surface glycoprotein, CD239

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84038-3-PBS targets BCAM in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28181

Product name: Recombinant human BCAM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 32-254 aa of BC050450

Sequence: EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSP

Predict reactive species
Full Name basal cell adhesion molecule (Lutheran blood group)
Calculated Molecular Weight 67 kDa
Observed Molecular Weight67 kDa, 78-85 kDa
GenBank Accession NumberBC050450
Gene Symbol BCAM
Gene ID (NCBI) 4059
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP50895
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Basal cell adhesion molecule (Lu/BCAM) is a membrane-bound glycoprotein of the immunoglobulin superfamily (IgSF), functioning as a receptor for the extracellular matrix protein, laminin. BCAM (Lutheran/basal cell-adhesion molecule, a glycoprotein) belongs to the immunoglobulin superfamily which contains both Lu blood group and BCAM tumor-associated antigens. Proteomics analysis suggests that BCAM might be a potential biomarker for pancreatic cancer (PMID: 19199705). BCAM, involved in cell adhesion and migration, can also promote tumor metastasis and has been elucidated to play a functional role in the metastasis of thyroid cancer and gastric cancer (PMID: 10728810, 35941663). De-glycosylated BCAM has a preidicted molecular weight of 67 kDa. Two BCAM glycoprotein (gp) isoforms are present on human RBCs, Lu (85 kDa) and Lu(v13) (78 kDa); they result from the alternative splicing of intron 13 and differ by the lengths of their cytoplasmic domains (PMID: 23160466).

Loading...
||
New chat Able
正在加载,请稍候...