BCAM Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84038-3-RR (same clone as 84038-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84038-3-RR (BCAM antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84038-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 84038-3-RR (same clone as 84038-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 84038-3-RR (BCAM antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84038-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84038-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84038-3-RR against Human BCAM were performed. The affinity constant is 6.16 nM.

BCAM Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84038-3-PBS

Clone No.241051C8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

241051C8, Auberger B antigen, Basal cell adhesion molecule, B-CAM cell surface glycoprotein, CD239

---

Product Information

84038-3-PBS targets BCAM in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28181

  Product name: Recombinant human BCAM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-254 aa of BC050450

  Sequence: EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSP

• Full Name: basal cell adhesion molecule (Lutheran blood group)
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 67 kDa, 78-85 kDa
• GenBank Accession Number: BC050450
• Gene Symbol: BCAM
• Gene ID (NCBI): 4059
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P50895
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Basal cell adhesion molecule (Lu/BCAM) is a membrane-bound glycoprotein of the immunoglobulin superfamily (IgSF), functioning as a receptor for the extracellular matrix protein, laminin. BCAM (Lutheran/basal cell-adhesion molecule, a glycoprotein) belongs to the immunoglobulin superfamily which contains both Lu blood group and BCAM tumor-associated antigens. Proteomics analysis suggests that BCAM might be a potential biomarker for pancreatic cancer (PMID: 19199705). BCAM, involved in cell adhesion and migration, can also promote tumor metastasis and has been elucidated to play a functional role in the metastasis of thyroid cancer and gastric cancer (PMID: 10728810, 35941663). De-glycosylated BCAM has a preidicted molecular weight of 67 kDa. Two BCAM glycoprotein (gp) isoforms are present on human RBCs, Lu (85 kDa) and Lu(v13) (78 kDa); they result from the alternative splicing of intron 13 and differ by the lengths of their cytoplasmic domains (PMID: 23160466).