BCAS1 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 25776-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 25776-1-AP (BCAS1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25776-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25776-1-AP (BCAS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 25776-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25776-1-AP (BCAS1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 25776-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 25776-1-AP (BCAS1 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 25776-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using BCAS1 antibody (25776-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

BCAS1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25776-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Breast carcinoma-amplified sequence 1, NABC1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, MCF-7 cells, NIH/3T3 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25776-1-AP targets BCAS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22760

  Product name: Recombinant human BCAS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-289 aa of BC126348

  Sequence: MGNQMSVPQRVEDQENEPEAETYKDNASALNGVPVVVSTHTVQHLEEVDLGISVKTDNVATSSPETTEISAVADANGKNLGKEAKPEAPAAKSRFFLMLSRPVPGRTGDQAADSSLGSVKLDVSSNKAPANKDPSESWTLPVAAGPGQDTDKTPGHAPAQDKALSAARDPTLLPPETGGAGGEAPSKPKDSSFFDKFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQSDDVPAGKDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQAAAIAENNNSIMS

• Full Name: breast carcinoma amplified sequence 1
• Calculated Molecular Weight: 584 aa, 62 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC126348
• Gene Symbol: BCAS1
• Gene ID (NCBI): 8537
• RRID: AB_2880235
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75363
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Joey (Verified Customer) (02-03-2026)

It is a very specific antibody showing one and unique band in Western Blot and beautiful staining in IF

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1/500
• Cell Tissue Type: Mouse neural stem cells