BCAS2 Polyclonal antibody

• 

  WB analysis using 10414-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10414-1-AP (BCAS2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10414-1-AP

  WB result of BCAS2 antibody (10414-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BCAS2 transfected HeLa cells.

• 

  WB analysis of hESC using 10414-1-AP

  hESC cells were subjected to SDS PAGE followed by western blot with 10414-1-AP (BCAS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COS-7 using 10414-1-AP

  COS-7 cells were subjected to SDS PAGE followed by western blot with 10414-1-AP (BCAS2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 10414-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10414-1-AP (BCAS2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 10414-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 10414-1-AP (BCAS2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 10414-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10414-1-AP (BCAS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 10414-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10414-1-AP (BCAS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10414-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10414-1-AP (BCAS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 10414-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 10414-1-AP (BCAS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 10414-1-AP

  IP result of anti-BCAS2 (IP:10414-1-AP, 3ug; Detection:10414-1-AP 1:1000) with mouse brain tissue lysate 6500ug.

• 

  IHC staining of human prostate cancer using 10414-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10414-1-AP (BCAS2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 10414-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10414-1-AP (BCAS2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 10414-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10414-1-AP (BCAS2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human prostate cancer using 10414-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10414-1-AP (BCAS2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 10414-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10414-1-AP (BCAS2 antibody) at dilution of 1:100 (under 25x lens).

• 

  IF Staining of HeLa using 10414-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BCAS2 antibody (10414-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of MCF-7 using 10414-1-AP

  Immunofluorescent analysis of MCF-7 cells using 10414-1-AP (BCAS2 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

BCAS2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10414-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

Synonyms

Spliceosome-associated protein SPF 27, Pre-mRNA-splicing factor SPF27, Pre mRNA splicing factor SPF27, DAM1, Breast carcinoma-amplified sequence 2

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse brain tissue, mouse liver tissue, hESC cells, human brain tissue, K-562 cells, COS-7 cells, SH-SY5Y cells, PC-12 cells, C6 cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human prostate cancer tissue, human colon cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 7 publications below
• IHC: See 1 publications below
• IF: See 3 publications below
• RIP: See 1 publications below

Product Information

10414-1-AP targets BCAS2 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0669

  Product name: Recombinant human BCAS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC005285

  Sequence: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

• Full Name: breast carcinoma amplified sequence 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26-32 kDa
• GenBank Accession Number: BC005285
• Gene Symbol: BCAS2
• Gene ID (NCBI): 10286
• RRID: AB_2063400
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75934
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCAS2 associates with the spliceosome and implicates in mRNA splicing

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; BCAS2 is involved in alternative mRNA splicing in spermatogonia and the transition to meiosis.; Authors - Wenbo Liu
	WB	Int J Biochem Cell Biol; BCAS2 interacts with HSF4 and negatively regulates its protein stability via ubiquitination.; Authors - Shengjie Liao
mouse	WB,IF	Stem Cell Res Ther; Breast carcinoma-amplified sequence 2 regulates adult neurogenesis via β-catenin.; Authors - Hsin-Hsiung Chen ; KD Validated
human	IHC, WB	Br J Cancer; BCAS2 promotes prostate cancer cells proliferation by enhancing AR mRNA transcription and protein stability.; Authors - P-C Kuo ; KD Validated
mouse	WB,IF	FASEB J; BCAS2 is involved in alternative splicing and mouse oocyte development.; Authors - Jiaqi Zhang ; KO Validated
mouse	WB,RIP	Endocrinology; BCAS2 participates in insulin synthesis and secretion via mRNA alternative splicing in mice; Authors - Xuexue Chen