BCAS3 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 67085-1-Ig (same clone as 67085-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67085-1-Ig (BCAS3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67085-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67085-1-Ig (same clone as 67085-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67085-1-Ig (BCAS3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67085-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51587-1

  Cytometric bead array sample test of MP51587-1, BCAS3 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67085-2-PBS. Detection antibody: 67085-1-PBS.

• 

  Cytometric bead array standard curve of MP51587-1

  Cytometric bead array standard curve of MP51587-1, BCAS3 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67085-2-PBS. Detection antibody: 67085-1-PBS. Standard:Ag28545. Range: 0.391-50 ng/mL.

BCAS3 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 67085-1-PBS

Clone No.1G7B1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

---

Product Information

67085-1-PBS targets BCAS3 as part of a matched antibody pair:

MP51587-1: 67085-2-PBS capture and 67085-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28545

  Product name: Recombinant human BCAS3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 653-928 aa of BC001250

  Sequence: SWTLVRTPQWNELQPPFNANHPLLLAADAVQYYQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPTGFP

• Full Name: breast carcinoma amplified sequence 3
• Calculated Molecular Weight: 99 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC001250
• Gene Symbol: BCAS3
• Gene ID (NCBI): 54828
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H6U6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Rudhira/BCAS3 (Breast Cancer Amplified Sequence 3) is a conserved protein expressed in the embryonic vasculature and malignant tumors. Rudhira is a predicted WD40 domain protein. During mouse development Rudhira is expressed in erythropoietic and angiogenic precursors but not in their differentiated progeny. This transient expression of Rudhira is also seen in normal adult angiogenesis. BCAS3, the human ortholog of Rudhira is 98% identical and the gene maps to a breakpoint of hematological neoplasms on chromosome 17q23.1. BCAS3 is also expressed in vascular development in embryoid bodies in vitro and was originally identified as a gene over-expressed in breast cancers. It is reported to be a target of metastasis associated protein-1 (MTA-1). Further BCAS3 expression is also upregulated in grade III and IV glioblastomas where it is misexpressed in the tumor cells.