Tested Applications
| Positive WB detected in | mouse liver tissue, Transfected HEK-293 cells, rat liver tissue |
| Positive IHC detected in | human colon cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13685-1-AP targets BCKDHB in WB, IHC, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4552 Product name: Recombinant human BCKDHB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 41-392 aa of BC040139 Sequence: TVEDAAQRRQVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY Predict reactive species |
| Full Name | branched chain keto acid dehydrogenase E1, beta polypeptide |
| Calculated Molecular Weight | 392 aa, 43 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC040139 |
| Gene Symbol | BCKDHB |
| Gene ID (NCBI) | 594 |
| RRID | AB_2877972 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21953 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Branched-chain alpha-keto acid dehydrogenase E1 component beta chain (BCKDHB; BCKDE1B; BCKDH E1-beta) is a subunit of the BCKDH complex, which is a mitochondrial enzyme in the degradation pathway for branched-chain amino acids (BCAA). Together with BCKDHA, BCKDHB forms the E1 subunit of this complex, whereas DBT and DLD are the E2 and E3 subunits, respectively. A deficiency of the BCKDH complex in humans causes maple syrup urine disease (MSUD), a severe neurometabolic disorder diagnosed by the detection alloisoleucine in plasma (MIM 248600). (PMID: 30709776)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BCKDHB antibody 13685-1-AP | Download protocol |
| WB protocol for BCKDHB antibody 13685-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The BCKDHB polyclonal antibody (Cat# 13685-1-AP) has 12 citations published in journals including Nature Cancer, Nature Communications, Science Translational Medicine, Nucleic Acids Research, Advanced Science, Cancer Letters, Cell Reports, Journal of Thrombosis and Haemostasis, FASEB Journal, World Allergy Organization Journal, and Animal Science Journal. Research fields span branched-chain amino acid metabolism, cancer (prostate, liver, lung), cardiac hypertrophy, maple syrup urine disease, thrombocytopoiesis, ferroptosis, and adipogenesis.
| Species | Application | Title |
|---|---|---|
Nat Cancer Integrative proteogenomic profiling of high-risk prostate cancer samples from Chinese patients indicates metabolic vulnerabilities and diagnostic biomarkers | ||
Nat Commun AMPK induces degradation of the transcriptional repressor PROX1 impairing branched amino acid metabolism and tumourigenesis | ||
Sci Transl Med BCKDHA-BCKDHB digenic gene therapy restores metabolic homeostasis in two mouse models and a calf with classic maple syrup urine disease | ||
Nucleic Acids Res Mitolnc controls cardiac BCAA metabolism and heart hypertrophy by allosteric activation of BCKDH | ||
Adv Sci (Weinh) Inhibition of CDH11 Activates cGAS-STING by Stimulating Branched Chain Amino Acid Catabolism and Mitigates Lung Metastasis of Adenoid Cystic Carcinoma | ||
Cancer Lett CPT1A loss disrupts BCAA metabolism to confer therapeutic vulnerability in TP53-mutated liver cancer |
Reviews
What customers say
One reviewer (Emilie O., September 2025) gave this antibody a perfect 5-star rating for Western Blot on fibroblasts at a 1:1000 dilution, noting robust signal and consistent, reliable results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Emilie (Verified Customer) (09-24-2025) | Robust signal at 1:1000. Consistent and reliable WB results.
|
