BCL11A Polyclonal antibody

BCL11A Polyclonal Antibody for WB, IHC, ELISA
Cat No. 11613-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

B cell lymphoma/leukaemia 11A, B-cell CLL/lymphoma 11A, B-cell lymphoma/leukemia 11A, BCL-11A, COUP-TF-interacting protein 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDaudi cells
Positive IHC detected inhuman tonsillitis tissue, human gliomas tissue, mouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11613-1-AP targets BCL11A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2187

Product name: Recombinant human BCL11A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC021098

Sequence: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPRVGIPSGLGAECPSQPPLHGIHIADNNPFNLLRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIERLGAEEMALATHHPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGSK

Predict reactive species
Full Name B-cell CLL/lymphoma 11A (zinc finger protein)
Calculated Molecular Weight 835 aa, 91 kDa
GenBank Accession NumberBC021098
Gene Symbol BCL11A
Gene ID (NCBI) 53335
RRIDAB_2259028
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H165
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

B-CELL CLL/LYMPHOMA 11A(BCL11A)is a highly conserved zinc finger gene. It acts as a myeloid and B-cell proto-oncogene, and may play key roles in leukemogenesis and hematopoiesis. It is an essential factor in lymphopoiesis, and required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1. It is also involved in lymphoid malignancies through translocation or amplification events. It has recently been shown that BCL11A expression is inversely correlated with γ globin expression.(PMID:21156846). This is a rabbit polyclonal antibody raised against part chain of N-terminal BCL11A of human origin. There are three isoforms of BCL11A: isoform1(773aa), isoform2(486aa) and isoform3(239aa)

Protocols

Product Specific Protocols
WB protocol for BCL11A antibody 11613-1-APDownload protocol
IHC protocol for BCL11A antibody 11613-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...