BCL2L12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BCL2L12 Polyclonal antibody, PBS Only (21969-1-PBS)

• 

  WB analysis of PC-3 using 21969-1-AP (same clone as 21969-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 21969-1-AP (BCL2L12 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21969-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 21969-1-AP (same clone as 21969-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 21969-1-AP (BCL2L12 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 21969-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 21969-1-AP (same clone as 21969-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 21969-1-AP (BCL2L12 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 21969-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 21969-1-AP (same clone as 21969-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed PC-3 cells using 21969-1-AP (BCL2L12 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21969-1-PBS in a different storage buffer formulation.

BCL2L12 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21969-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

21969-1-PBS targets BCL2L12 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16856

  Product name: Recombinant human BCL2L12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-334 aa of BC104005

  Sequence: MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPRSPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD

• Full Name: BCL2-like 12 (proline rich)
• Calculated Molecular Weight: 334 aa, 37 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC104005
• Gene Symbol: BCL2L12
• Gene ID (NCBI): 83596
• RRID: AB_2878956
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HB09
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.