• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated BCLAF1 Monoclonal antibody

BCLAF1 Monoclonal Antibody for FC (Intra)
Cat No. CL594-67860
Clone No.1D6G7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

FC (Intra)

KIAA0164, Btf, BCLAF1 and THRAP3 family member 1, Bcl-2-associated transcription factor 1, 1D6G7

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67860 targets BCLAF1 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25210

Product name: Recombinant human BCLAF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 881-920 aa of BC132780

Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE

Predict reactive species
Full Name BCL2-associated transcription factor 1
Calculated Molecular Weight 920 aa, 106 kDa
Observed Molecular Weight145 kDa
GenBank Accession NumberBC132780
Gene Symbol BCLAF1
Gene ID (NCBI) 9774
RRIDAB_2934782
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NYF8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa.

Protocols

Product Specific Protocols
FC protocol for CL594 BCLAF1 antibody CL594-67860Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...