Tested Applications
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-67860 targets BCLAF1 in FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25210 Product name: Recombinant human BCLAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 881-920 aa of BC132780 Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE Predict reactive species |
| Full Name | BCL2-associated transcription factor 1 |
| Calculated Molecular Weight | 920 aa, 106 kDa |
| Observed Molecular Weight | 145 kDa |
| GenBank Accession Number | BC132780 |
| Gene Symbol | BCLAF1 |
| Gene ID (NCBI) | 9774 |
| RRID | AB_2934782 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9NYF8 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
BCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL594 BCLAF1 antibody CL594-67860 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

