CoraLite® Plus 488-conjugated BCLAF1 Monoclonal antibody

• 

  FC experiment of HepG2 using CL488-67860

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human BCLAF1 (CL488-67860, Clone:1D6G7) (red), or 0.4 ug Mouse IgG1 Isotype Control (CL488-66360, Clone: T1F8D3F10) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

BCLAF1 Monoclonal Antibody for FC (Intra)

Cat No. CL488-67860

Clone No.1D6G7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

KIAA0164, Btf, BCLAF1 and THRAP3 family member 1, Bcl-2-associated transcription factor 1, 1D6G7

---

Tested Applications

• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67860 targets BCLAF1 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25210

  Product name: Recombinant human BCLAF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 881-920 aa of BC132780

  Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE

• Full Name: BCL2-associated transcription factor 1
• Calculated Molecular Weight: 920 aa, 106 kDa
• Observed Molecular Weight: 145 kDa
• GenBank Accession Number: BC132780
• Gene Symbol: BCLAF1
• Gene ID (NCBI): 9774
• RRID: AB_2923808
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NYF8
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

BCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa.