Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Human BCMA/TNFRSF17 Rabbit Recombinant Antibody, PBS Only (98215-1-PBS)

Anti-Human BCMA/TNFRSF17 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Human BCMA/TNFRSF17 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98215-1-PBS-1MG

BCMA/TNFRSF17 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98215-1-PBS

Clone No. 241731A11

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Synonyms

TNFRSF17, 241731A11, B-cell maturation protein, BCM, BCMA

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFCAffinity

FC experiment of U266 using 98215-1-RR (same clone as 98215-1-PBS)
1x10^6 U266 cells (left) or HEK-293T (right) were surface stained with 0.25 ug Anti-Human BCMA/TNFRSF17 Rabbit Recombinant Antibody (98215-1-RR, Clone: 241731A11) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98215-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 U266 cells (left) or HEK-293T (right) were surface stained with 0.25 ug Anti-Human BCMA/TNFRSF17 Rabbit Recombinant Antibody (98215-1-RR, Clone: 241731A11) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98215-1-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 98215-1-RR
Biolayer interferometry (BLl) kinetic assays of 98215-1-RR against Human BCMA/TNFRSF17 were performed. The affinity constant is 0.20 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BCMA/TNFRSF17 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98215-1-PBS targets BCMA/TNFRSF17 in FC applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg1812 Product name: Recombinant Human BCMA/TNFRSF17 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-54 aa of BC058291 Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Predict reactive species
Full Name	tumor necrosis factor receptor superfamily, member 17
Calculated Molecular Weight	184 aa, 20 kDa
GenBank Accession Number	BC058291
Gene Symbol	TNFRSF17
Gene ID (NCBI)	608
RRID	AB_3745882
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q02223
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

BCMA (B cell maturation antigen), also known as TNFRSF17, is 20.2-kDa type III transmembrane glycoprotein and is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes and plasma cells, which may be important for B cell development and autoimmune response (PMID: 32943087; 9846698). BCMA has two agonist ligands: a proliferation-inducing ligand (APRIL) and BAFF. When BCMA binds to APRIL, it transmits signals of cell survival and proliferation (PMID: 27127303); when BCMA binds to BAFF, it mediates the activation of NF-kappaB and MAPK8/JNK (PMID: 36140254). It has been found that the overexpression and activation of BCMA are associated with multiple myeloma (MM) in preclinical models and humans, supporting its potential utility as a therapeutic target for MM (PMID: 32055000; 32943087).