• Featured Product
  • KD/KO Validated

Beclin 1 Polyclonal antibody

Beclin 1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA
Cat No. 11306-1-AP
Publications(1115)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ELISA

BECN1, Beclin-1-C 37 kDa, Beclin-1-C 35 kDa, Beclin-1, Beclin1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC6 cells, HEK-293 cells, Raji cells, L02 cells, PC-3 cells, A431 cells, HT-1080 cells, human placenta tissue, mouse brain tissue, rat brain tissue, HeLa cells, NIH/3T3 cells, MDA-MB-453s cells, SH-SY5Y cells
Positive IP detected inMDA-MB-453s cells
Positive IHC detected inhuman breast cancer tissue, human breast hyperplasia tissue, human prostate hyperplasia tissue, human cervical cancer tissue, human colon cancer tissue, human stomach tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue
Positive IF-Fro detected inmouse heart tissue
Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11306-1-AP targets Beclin 1 in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, zebrafish, hamster, sheep, goat, fish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1843

Product name: Recombinant human Beclin 1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 141-450 aa of BC010276

Sequence: TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK

Predict reactive species
Full Name beclin 1, autophagy related
Calculated Molecular Weight 52 kDa
Observed Molecular Weight52-60 kDa
GenBank Accession NumberBC010276
Gene Symbol Beclin 1
Gene ID (NCBI) 8678
RRIDAB_2259061
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14457
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beclin 1, also known as ATG6 or VPS30, interacts with various cofactors (e.g. Ambra1, Barkor (Atg14), Rubicon, or UVRAG) to regulate the lipid kinase Vps34 and promote the formation of the BECLIN1-Vps34-Vps15 complex, hence inducing autophagy. Its function (via the BH3 domain) is inhibited by Bcl-2 or Bcl-XL. Beclin 1 (BECN1) is a crucial molecule in the control of the autophagic activity, and its activity is regulated by multiple mechanisms, including the post-translational modification, protein-protein interaction, and subcellular localization. It plays a role in crosstalk between apoptosis and autophagy. It has been reported that Beclin 1 can be cleaved into fragments of 50, 37 and 35 kDa during apoptosis. It is involved in many disorders, including neurodegeneration and cancer (tumorigenesis). Beclin 1 is a mammalian tumor suppressor, and its gene is monoallelically deleted in 75% of ovarian, 50% of breast, and 40% of prostate cancers. Decreased expression of Beclin 1 has also been observed in human brain and lung tumors. The level of Beclin 1 was decreased in the affected brain regions of patients with Alzheimer's disease early in the disease process. Recent studies have also shown that gain and loss of Beclin 1 function affects the death of heart cells.

Protocols

Product Specific Protocols
IF protocol for Beclin 1 antibody 11306-1-APDownload protocol
IHC protocol for Beclin 1 antibody 11306-1-APDownload protocol
IP protocol for Beclin 1 antibody 11306-1-APDownload protocol
WB protocol for Beclin 1 antibody 11306-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

TEX264 drives selective autophagy of DNA lesions to promote DNA repair and cell survival

Authors - Pauline Lascaux
humanWB,IP

Signal Transduct Target Ther

Targeting CRL4 suppresses chemoresistant ovarian cancer growth by inducing mitophagy

Authors - Yang Meng
humanWB

Mol Cancer

Overcoming multi-drug resistance in SCLC: a synergistic approach with venetoclax and hydroxychloroquine targeting the lncRNA LYPLAL1-DT/BCL2/BECN1 pathway

Authors - Shuxin Li
humanWB

Nat Microbiol

Kaposi's sarcoma-associated herpesvirus induces mitochondrial fission to evade host immune responses and promote viral production

Authors - Qing Zhu
mouseIF

ACS Nano

Neutrophil Nanovesicle Protects against Experimental Autoimmune Encephalomyelitis through Enhancing Myelin Clearance by Microglia

Authors - Shishi Shen
humanWB,IHC

Cancer Commun (Lond)

Targeting autophagy overcomes cancer-intrinsic resistance to CAR-T immunotherapy in B-cell malignancies

Authors - Lu Tang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jenna (Verified Customer) (07-28-2025)

The product was easy to use and provided all necessary information for successful completion of western blot procedures. The recommended amount did turn out to be the appropriate amount for our experimental purpose. Our success with this product encourages us to continue to use this product

  • Applications: Western Blot
  • Cell Tissue Type: Liver
FH

James (Verified Customer) (11-30-2022)

This antibody works well in WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Liver
Beclin 1 Antibody Western Blot validation (1/1000 dilution) in Liver (Cat no:11306-1-AP)
FH

Jonathan (Verified Customer) (04-08-2022)

Antibody worked well - gave a nice, specific and strong signal. Happy.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 in 1000
  • Cell Tissue Type: Vero cells (African Green Monkey)
FH

Zhengnan (Verified Customer) (02-24-2022)

The antibody is very good, got correct bands and background is clear!

  • Applications: Western Blot
FH

David (Verified Customer) (03-30-2020)

Used for immunoblot, single band at expected molecular weight, good signal to noise ratio

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: SH-SY5Y
FH

Kanika (Verified Customer) (09-18-2019)

Works well at the recommended dilution for western blotting.Immunofluorescence signal was variable/low even with same concentration in replicate experiments.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human platelets
Beclin 1 Antibody Western Blot,Immunofluorescence, validation (1:1000 dilution) in Human platelets (Cat no:11306-1-AP)
FH

Kishor (Verified Customer) (01-30-2019)

Working well for Western Blotting (1:5000) and IF (1:300)

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: H69, HUCCT-1
Beclin 1 Antibody Western Blot,Immunofluorescence, validation (1:1000 dilution) in H69, HUCCT-1 (Cat no:11306-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...