BEGAIN Polyclonal antibody

BEGAIN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14956-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Brain-enriched guanylate kinase-associated protein, KIAA1446

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 14956-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 14956-1-AP (BEGAIN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse pancreas using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse adrenal gland using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded mouse adrenal gland tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat adrenal gland using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded rat adrenal gland tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 14956-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14956-1-AP (BEGAIN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BEGAIN in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, JAR cells, SH-SY5Y cells
Positive IHC detected in	human pancreas cancer tissue, human stomach cancer tissue, mouse adrenal gland tissue, rat adrenal gland tissue, mouse brain tissue, mouse cerebellum tissue, mouse pancreas tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14956-1-AP targets BEGAIN in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag6794 Product name: Recombinant human BEGAIN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 225-593 aa of BC002607 Sequence: DIYCSDTALYCPEERRRDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFAKATAAVAAPLEAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQGSRDSLEPSSMEASPEMHPAARLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN Predict reactive species
Full Name	brain-enriched guanylate kinase-associated homolog (rat)
Calculated Molecular Weight	65 kDa
Observed Molecular Weight	65-70 kDa
GenBank Accession Number	BC002607
Gene Symbol	BEGAIN
Gene ID (NCBI)	57596
RRID	AB_2064487
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9BUH8
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for BEGAIN antibody 14956-1-AP	Download protocol
WB protocol for BEGAIN antibody 14956-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The BEGAIN Polyclonal antibody (Cat# 14956-1-AP) has 1 citation. It was cited in PLoS One in a 2015 study on the nationwide survey and genetic analyses of Bardet-Biedl Syndrome in Japan, where it was used for Western blot in human samples. The research field is genetic disease/ophthalmology, specifically related to ciliopathy and inherited retinal disorders.