BEND4 Polyclonal antibody

• 

  WB analysis of mouse testis using 24711-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24711-1-AP (BEND4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 24711-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 24711-1-AP (BEND4 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon cancer using 24711-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24711-1-AP (BEND4 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human heart using 24711-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 24711-1-AP (BEND4 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon cancer using 24711-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24711-1-AP (BEND4 Antibody) at dilution of 1:50 (under 10x lens).

BEND4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24711-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

BEN domain containing 4, BEND4, CCDC4

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: human colon cancer tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

24711-1-AP targets BEND4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20169

  Product name: Recombinant human BEND4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-305 aa of BC128592

  Sequence: SLELSAESRMILDAFAQQCSRVLSLLNCGGKLLDSNHSQSMISCVKQEGSSYNERQEHCHIGKGVHSQTSDNVDIEMQYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVDPLSTSPVHTLGGWTSPATSESHGHPSSSTLPEEEEEEDEEGYCPRCQELEQEVISLQQENEELRRKLESIPVPCQTVLDYLKMVLQHHNQLLIPQPADQPTEGSKQLLNNYPVYITSKQWDEAVNSSKKDGRRLLRYLIRFVFTTDELKYSCGL

• Full Name: BEN domain containing 4
• Calculated Molecular Weight: 534 aa, 58 kDa
• Observed Molecular Weight: 55-58 kDa, 33-36 kDa
• GenBank Accession Number: BC128592
• Gene Symbol: BEND4
• Gene ID (NCBI): 389206
• RRID: AB_2879684
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZU67
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BEND4, also named as CCDC4, has 5 isoforms with MW 55-58 kDa, 45-48 kDa and 36 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Elife; scRNA-seq and scATAC-seq reveal that Sertoli cell mediates spermatogenesis disorders through stage-specific communications in non-obstructive azoospermia; Authors - Shimin Wang