Product Information
11794-1-PBS targets BET1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2261 Product name: Recombinant human BET1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC000899 Sequence: MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR Predict reactive species |
| Full Name | blocked early in transport 1 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC000899 |
| Gene Symbol | BET1 |
| Gene ID (NCBI) | 10282 |
| RRID | AB_3085381 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15155 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



