Filter: AllWBIHC

WB analysis using 11794-1-AP (same clone as 11794-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 11794-1-AP (BET1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11794-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 11794-1-AP (same clone as 11794-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11794-1-AP (BET1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11794-1-PBS in a different storage buffer formulation.

BET1 Polyclonal antibody, PBS Only

Name: BET1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 11794-1-PBS

BET1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11794-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

hBET1, Golgi vesicular membrane-trafficking protein p18, BET1 homolog

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

11794-1-PBS targets BET1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2261 Product name: Recombinant human BET1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC000899 Sequence: MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR Predict reactive species
Full Name	blocked early in transport 1 homolog (S. cerevisiae)
Calculated Molecular Weight	13 kDa
Observed Molecular Weight	13 kDa
GenBank Accession Number	BC000899
Gene Symbol	BET1
Gene ID (NCBI)	10282
RRID	AB_3085381
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O15155
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™