Beta ENaC Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Beta ENaC Polyclonal antibody (14134-1-AP)

• Featured Product
• KD/KO Validated

Beta ENaC Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14134-1-AP Copied!

Publications (17)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

SCNN1B, Amiloride-sensitive sodium channel subunit beta, Beta NaCH, Beta-ENaC, Beta-NaCH

• 

  WB analysis of PC-3 using 14134-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 14134-1-AP (β-ENaC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14134-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14134-1-AP (Beta ENaC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 14134-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 14134-1-AP (β-ENaC antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14134-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14134-1-AP (β-ENaC Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 14134-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14134-1-AP (β-ENaC Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Beta ENaC in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human placenta tissue, mouse kidney tissue, PC-3 cells, rat kidney tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14134-1-AP targets Beta ENaC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5348

  Product name: Recombinant human β-ENaC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 68-401 aa of BC036352

  Sequence: GIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNC

• Full Name: sodium channel, nonvoltage-gated 1, beta
• Calculated Molecular Weight: 640 aa, 73 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC036352
• Gene Symbol: Beta ENaC
• Gene ID (NCBI): 6338
• RRID: AB_2184378
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51168
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCNN1B, also named as SCNEB, ENaCB, Beta-NaCH and Beta-ENaC, belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family and SCNN1B subfamily. Sodium permeable non-voltage-sensitive ion channel is inhibited by the diuretic amiloride. SCNN1B mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. It controls the reabsorption of sodium in kidney, colon, lung and sweat glands. SCNN1B plays a role in taste perception.

Publications

What published studies show

The Beta ENaC Polyclonal antibody (Cat# 14134-1-AP) has 17 citations spanning journals including J Exp Med, EMBO J, Cell Mol Life Sci, Matrix Biol, Int Immunopharmacol, Front Pharmacol, J Neurotrauma, Exp Cell Res, and others. Research fields cover epithelial sodium channel function, acute lung injury, intestinal ion homeostasis, kidney disease, sepsis, lipid metabolism, and spinal cord injury, with applications primarily in WB, IHC, and IF across human, mouse, rat, pig, and hamster species.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Exp Med; Single-cell transcriptome analysis reveals differential nutrient absorption functions in human intestine.; Authors - Yalong Wang
		EMBO J; The Nedd4L ubiquitin ligase is activated by FCHO2-generated membrane curvature; Authors - Yasuhisa Sakamoto
pig	WB	Anim Nutr; Glutamine in suppression of lipopolysaccharide-induced piglet intestinal inflammation: The crosstalk between AMPK activation and mitochondrial function.; Authors - Liuqin He
mouse	IF	Environ Pollut; Ozone exposure induced kidney damage in diabetic mice: the key role of lipid metabolism and water-electrolyte homeostasis; Authors - Yaru Zhang
pig	WB	J Agric Food Chem; AMPK/α-Ketoglutarate Axis Regulates Intestinal Water and Ion Homeostasis in Young Pigs; Authors - Liuqin He
mouse	WB	Cell Mol Life Sci; PEBP4 deficiency aggravates LPS-induced acute lung injury and alveolar fluid clearance impairment via modulating PI3K/AKT signaling pathway; Authors - Qiao-Qing Shi

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

The single review for this product rates it 4 out of 5 stars. The reviewer used it for Western Blot on H441 cells at a 1:800 dilution and simply described the performance as "Good." Overall, the feedback is positive, indicating satisfactory results for the tested application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

S (Verified Customer) (06-17-2026)

Good

• Applications: Western Blot
• Primary Antibody Dilution: 800
• Cell Tissue Type: H441

Beta ENaC Antibody Western Blot validation (800 dilution) in H441 (Cat no:14134-1-AP)