BEX4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BEX4 Polyclonal antibody, PBS Only (27525-1-PBS)

• 

  WB analysis using 27525-1-AP (same clone as 27525-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27525-1-AP (BEX4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27525-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 27525-1-AP (same clone as 27525-1-PBS)

  WB result of BEX4 antibody (27525-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-BEX4 transfected HL-60 cells. This data was developed using the same antibody clone with 27525-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BEX4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27525-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Protein BEX4, NADE3, brain expressed, X linked 4, BEXL1, BEX1 like protein 1

---

Product Information

27525-1-PBS targets BEX4 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26207

  Product name: Recombinant human BEX4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of BC015794

  Sequence: MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP

• Full Name: brain expressed, X-linked 4
• Calculated Molecular Weight: 120 aa, 14 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC015794
• Gene Symbol: BEX4
• Gene ID (NCBI): 56271
• RRID: AB_3669608
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWD9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BEX4, also known as BEXL1 and NADE3, which belongs to the BEX family. The brain-expressed X-linked (BEX) family consists of five member genes (from 1 to 5) that are commonly located on the X chromosome. The molecular weight of BEXs is approximately 15 kDa, but little is known about their structural characteristics and molecular functions (PMID: 34576008).