Filensin Polyclonal antibody

• 

  WB analysis using 17492-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 17492-1-AP (Filensin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 17492-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Filensin antibody (17492-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Filensin Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 17492-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

BFSP1, LIFL-H, Lens intermediate filament-like heavy, Lens fiber cell beaded-filament structural protein CP 115, Filensin N-terminal fragment

---

Tested Applications

• Positive WB detected in: mouse eye tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17492-1-AP targets Filensin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11591

  Product name: Recombinant human BFSP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 192-540 aa of BC041483

  Sequence: GNRLTSAFIETPIPLFTQSHGVSLSTGSGGKDLTRALQDITAAKPRQKALPKNVPRRKEIITKDKTNGALEDAPLKGLEDTKLVQVVLKEESESKFESESKEVSPLTQEGAPEDVPDGGQISKGFGKLYRKVKEKVRSPKEPETPTELYTKERHVLVTGDANYVDPRFYVSSITAKGGVAVSVAEDSVLYDGQVEPSPESPKPPLENGQVGLQEKEDGQPIDQQPIDKEIEPDGAELEGPEEKREGEERDEESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKSS

• Full Name: beaded filament structural protein 1, filensin
• Calculated Molecular Weight: 540aa,60 kDa; 665aa,75 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC041483
• Gene Symbol: Filensin
• Gene ID (NCBI): 631
• RRID: AB_2228016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12934
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.