BIRC6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BIRC6 Polyclonal antibody, PBS Only (29760-1-PBS)

• 

  WB analysis using 29760-1-AP (same clone as 29760-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29760-1-AP (BIRC6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29760-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 29760-1-AP (same clone as 29760-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 29760-1-AP (BIRC6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29760-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 29760-1-AP (same clone as 29760-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 29760-1-AP (BIRC6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29760-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 29760-1-AP (same clone as 29760-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using BIRC6 antibody (29760-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29760-1-PBS in a different storage buffer formulation.

BIRC6 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29760-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

29760-1-PBS targets BIRC6 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30729

  Product name: Recombinant human BIRC6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4710-4857 aa of NM_016252

  Sequence: GYERSRGTPSGTQSSREYDGNIRQATVKWAMLEQIRNPSPCFKEVIHKHFYLKRVEIMAQCEEWIADIQQYSSDKRVGRTMSHHAAALKRHTAQLREELLKLPCPEGLDPDTDDAPEVCRATTGAEETLMHDQVKPSSSKELPSDFQL

• Full Name: baculoviral IAP repeat-containing 6
• Calculated Molecular Weight: 530 kDa
• Observed Molecular Weight: 530 kDa
• GenBank Accession Number: NM_016252
• Gene Symbol: BIRC6
• Gene ID (NCBI): 57448
• RRID: AB_2923604
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR09
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BIRC6 (Baculoviral IAP Repeat Containing 6), also known as BRUCE or APOLLON, is a member of the Inhibitors of Apoptosis Protein (IAP) family with a single BIR domain at its N-terminal and an active ubiquitin-conjugating (UBC) enzyme domain at its C-terminal(PMID: 23409057). In addition to its IAP activity, BIRC6 has the distinctive property of activity as a chimeric E2/E3 ubiquitin ligase in mammals. With its UBC domain, BIRC6 promotes the degradation of Smac and inhibits the activity of caspase-9, which play key roles in the initiation of apoptosis(PMID: 25933218). BIRC6 is highly expressed in many cancer types, where elevated expression of BIRC6 is significantly correlated with poor clinical outcome(PMID: 34729249).