BLCAP Polyclonal antibody

• 

BLCAP Polyclonal Antibody for ELISA

Cat No. 14218-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

Bladder cancer 10 kDa protein, BLCAP

---

Product Information

14218-1-AP targets BLCAP in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5456

  Product name: Recombinant human BLCAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-87 aa of BC047692

  Sequence: MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT

• Full Name: bladder cancer associated protein
• Calculated Molecular Weight: 10 kDa
• GenBank Accession Number: BC047692
• Gene Symbol: BLCAP
• Gene ID (NCBI): 10904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62952
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.