BLNK Polyclonal antibody

• 

  WB analysis of Raji using 10855-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10855-1-AP (BLNK Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Ramos using 10855-1-AP

  Ramos cells were subjected to SDS PAGE followed by western blot with 10855-1-AP (BLNK Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  IHC staining of human tonsillitis using 10855-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 10855-1-AP (BLNK Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 10855-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 10855-1-AP (BLNK Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 10855-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 10855-1-AP (BLNK antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 10855-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10855-1-AP (BLNK antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 10855-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10855-1-AP (BLNK antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of NIH/3T3 using 10855-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using BLNK antibody (10855-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

BLNK Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10855-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SLP65, Cytoplasmic adapter protein, B-cell linker protein, B-cell adapter containing a Src homology 2 domain protein, B-cell adapter containing a SH2 domain protein

---

Tested Applications

• Positive WB detected in: Raji cells, Ramos cells
• Positive IHC detected in: human tonsillitis tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

10855-1-AP targets BLNK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1290

  Product name: Recombinant human BLNK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-456 aa of BC018906

  Sequence: MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS

• Full Name: B-cell linker
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 68 kDa, 70 kDa
• GenBank Accession Number: BC018906
• Gene Symbol: BLNK
• Gene ID (NCBI): 29760
• RRID: AB_2274779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WV28
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IHC	Cytokine; Silencing BLNK protects against interleukin-1β-induced chondrocyte injury through the NF-κB signaling pathway.; Authors - Yi Cheng
mouse	WB	Aging (Albany NY); Plumbagin has an inhibitory effect on the growth of TSCC PDX model and it enhances the anticancer efficacy of cisplatin; Authors - Yuqi Xin