BLOC1S1 Polyclonal antibody

• 

  WB analysis using 33913-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33913-1-AP (BLOC1S1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

BLOC1S1 Polyclonal Antibody for WB, ELISA

Cat No. 33913-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Biogenesis of lysosome-related organelles complex 1 subunit 1, BLOC 1 subunit 1, BLOC-1 subunit 1, BLOS1, GCN5 like protein 1

---

Tested Applications

• Positive WB detected in: EC109 cells, HEK-293 cells, RAW 264.7 cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33913-1-AP targets BLOC1S1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35143

  Product name: Recombinant human BLOC1S1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-125 aa of BC132795

  Sequence: MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS

• Full Name: biogenesis of lysosomal organelles complex-1, subunit 1
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC132795
• Gene Symbol: BLOC1S1
• Gene ID (NCBI): 2647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78537
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BLOC1S1, also named as BLOS1, GCN5L1 and RT14, belongs to the BLOC1S1 family. BLOC1S1 may be involved in the biogenesis of specialized organelles of the endosomal-lysosomal system.