BMI1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• BMI1 Recombinant monoclonal antibody, PBS Only (87836-1-PBS)

BMI1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87836-1-PBS

Clone No.253339C8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

PCGF4, Polycomb complex protein BMI-1, Polycomb group RING finger protein 4, RNF51

• 

  WB analysis using 87836-1-RR (same clone as 87836-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87836-1-RR (BMI1 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87836-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 87836-1-RR (same clone as 87836-1-PBS)

  WB result of BMI1 antibody (87836-1-RR; 1:100000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BMI1 transfected HEK-293 cells. This data was developed using the same antibody clone with 87836-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87836-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87836-1-RR against Human BMI1 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87836-1-PBS targets BMI1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1286

  Product name: Recombinant human BMI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-326 aa of BC011652

  Sequence: MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

• Full Name: BMI1 polycomb ring finger oncogene
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 41-43 kDa
• GenBank Accession Number: BC011652
• Gene Symbol: BMI1
• Gene ID (NCBI): 648
• RRID: AB_3745777
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35226
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BMI- 1 is one of polycomb group genes, which together with Ring1 strongly enhances the E3 ubiquitin ligase activity of the Ring2 catalytic subunit. Bmi1 plays an important role in the regulation of cell proliferation and senescence through repression of the p16Ink4a and p19Arf genes and is required for maintenance of adult hematopoietic and neural stem cells. The antibody 10832-1-AP detected proteins of 45-48kda, which may include phosphorylated isoforms of the protein.