BMI1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Cytometric bead array sample test of MP03232-1

  The mean BMI1 concentration was determined to be 7.4 ng/mL in K-562 cell extract based on a 1.2 mg/mL extract load, 4.4 ng/mL in NIH/3T3 cell extract based on a 1.5 mg/mL extract load, 5.1 ng/mL in U-251 cell extract based on a 1.5 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP03232-1

  Cytometric bead array standard curve of MP03232-1, BMI1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87836-3-PBS. Detection antibody: 87836-2-PBS. Standard: Ag1286. Range: 1.25-80 ng/mL.

BMI1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 87836-3-PBS

Clone No.253339D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

PCGF4, Polycomb complex protein BMI-1, Polycomb group RING finger protein 4, RNF51

---

Product Information

87836-3-PBS targets BMI1 as part of a matched antibody pair:

MP03232-1: 87836-3-PBS capture and 87836-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1286

  Product name: Recombinant human BMI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-326 aa of BC011652

  Sequence: MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

• Full Name: BMI1 polycomb ring finger oncogene
• Calculated Molecular Weight: 37 kDa
• GenBank Accession Number: BC011652
• Gene Symbol: BMI1
• Gene ID (NCBI): 648
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35226
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.