BMP4 Monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP51307-1

  Plasma of fifteen individual healthy human donors was measured. The human BMP-4 concentration of detected samples was determined to be 186.93 ng/mL with a range of 4.33 - 855.65 ng/mL.

• 

  Sandwich ELISA standard curve of MP51307-1

  Sandwich ELISA standard curve of MP51307-1, Human GNAS Monoclonal Matched Antibody Pair - PBS only. 60897-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard HZ-1045. 69015-1-PBS was HRP conjugated as the detection antibody. Range: 23.4-1500 pg/mL

• 

  Cytometric bead array sample test of MP51307-1

  Cytometric bead array of cell line supernatant using MP51307-1, BMP-4 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60897-1-PBS. Detection antibody: 69015-1-PBS. Supernatant (50μL/well) from the following cell lines were assayed: HT-29, TF-1.

• 

  Cytometric bead array standard curve of MP51307-1

  Cytometric bead array standard curve of MP51307-1, BMP-4 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60897-1-PBS. Detection antibody: 69015-1-PBS. Standard:HZ-1045. Range: 6.25-100 ng/mL.

BMP4 Monoclonal Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 60897-1-PBS

Clone No.1B8E11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

BMP 4, BMP-4, BMP2B, BMP-2B, Bone morphogenetic protein 2B

---

Product Information

60897-1-PBS targets BMP4 as part of a matched antibody pair:

MP51307-1: 60897-1-PBS capture and 69015-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28840

  Product name: Recombinant human BMP4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 293-408 aa of BC020546

  Sequence: SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

• Full Name: bone morphogenetic protein 4
• Calculated Molecular Weight: 47 kDa
• GenBank Accession Number: BC020546
• Gene Symbol: BMP4
• Gene ID (NCBI): 652
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P12644
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.