BMPR1A Recombinant monoclonal antibody

• 

  Affinity and Kinetic Characterization of 82928-2-RR

  Biolayer interferometry (BLl) kinetic assays of 82928-2-RR against Human BMPR1A were performed. The affinity constant is below 1 pM.

BMPR1A Uni-rAb^® Recombinant Antibody for ELISA

Cat No. 82928-2-RR

Clone No.230137E12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

ALK3, ALK 3, ACVRLK3, Activin receptor-like kinase 3, Activin receptor like kinase 3

---

Product Information

82928-2-RR targets BMPR1A in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3410

  Product name: Recombinant human BMPR1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 174-427 aa of BC028383

  Sequence: FCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIM

• Full Name: bone morphogenetic protein receptor, type IA
• Calculated Molecular Weight: 532 aa, 60 kDa
• GenBank Accession Number: BC028383
• Gene Symbol: BMPR1A
• Gene ID (NCBI): 657
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36894
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BMPR1A (Bone morphogenetic protein receptor type-1A) is also named as ACVRLK3, ALK3 and SKR5. BMPR1A is an essential receptor for BMP signaling (PMID: 26279380). BMPR1A is necessary for chondrogenesis and osteogenesis (PMID: 32764110). BMPR1A is a cell surface marker of human SuSCs (PMID: 33658353).