BMPR1B Recombinant monoclonal antibody, PBS Only (Capture)

BMPR1B Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83029-4-PBS
Clone No.230244E12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

BMP type 1B receptor, BMP type-1B receptor, BMPR 1B, BMPR-1B, Bone morphogenetic protein receptor type-1B

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83029-4-PBS targets BMPR1B as part of a matched antibody pair:

MP00108-4: 83029-4-PBS capture and 83029-8-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24902

Product name: Recombinant human BMPR1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 16-57 aa of BC047773

Sequence: EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI

Predict reactive species
Full Name bone morphogenetic protein receptor, type IB
Calculated Molecular Weight 57 kDa
GenBank Accession NumberBC047773
Gene Symbol BMPR1B
Gene ID (NCBI) 658
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00238
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...