BMT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BMT2 Polyclonal antibody, PBS Only (21744-1-PBS)

• 

  WB analysis using 21744-1-AP (same clone as 21744-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21744-1-AP (C7orf60 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21744-1-PBS in a different storage buffer formulation.

BMT2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21744-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21744-1-PBS targets BMT2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16476

  Product name: Recombinant human C7orf60 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC114615

  Sequence: MEPGAGGRNTARAQRAGSPNTPPPREQERKLEQEKLSGVVKSVHRRLRKKYREVGDFDKIWREHCEDEETLCEYAVAMKNLADNHWAKTCEGEGRIEWCCSVCREYFQNGGKRKALEKDEKRAVLATKTTPALNMHESSQLEGHLTNLSFTNPEFITELLQASGKIRLLDVGSCFNPFLKFEEFLTVGIDIVPAVESVYKCDFLNLQLQQPLQLAQDAIDAFLKQLKNPIDSLPGELFHVVVFSLLLSYFPSPYQRWICCKKAHELLVLNGLLLIITPDSSHQNRHAMMMKSWKIAIESLGFKRFKYSKFSHMHLMAFRKISLKTTSDLVSRNYPGMLYIPQDFNSIEDE

• Full Name: chromosome 7 open reading frame 60
• Calculated Molecular Weight: 405 aa, 46 kDa
• Observed Molecular Weight: 46-50 kDa
• GenBank Accession Number: BC114615
• Gene Symbol: BMT2
• Gene ID (NCBI): 154743
• RRID: AB_2918073
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q1RMZ1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.