BNIP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BNIP2 Polyclonal antibody, PBS Only (10361-1-PBS)

• 

  WB analysis using 10361-1-AP (same clone as 10361-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10361-1-AP (BNIP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10361-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10361-1-AP (same clone as 10361-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BNIP2 antibody (10361-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 10361-1-PBS in a different storage buffer formulation.

• 

  IF Staining of RAW 264.7 using 10361-1-AP (same clone as 10361-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using BNIP2 antibody (10361-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10361-1-PBS in a different storage buffer formulation.

BNIP2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 10361-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

NIP2, BNIP 2, BCL2/adenovirus E1B 19 kDa protein-interacting protein 2

---

Product Information

10361-1-PBS targets BNIP2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0403

  Product name: Recombinant human BNIP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 144-313 aa of BC002461

  Sequence: MKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNE

• Full Name: BCL2/adenovirus E1B 19kDa interacting protein 2
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC002461
• Gene Symbol: BNIP2
• Gene ID (NCBI): 663
• RRID: AB_3085366
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12982
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (BNIP2) is also named as PRKACN2. BNIP2 is developmentally regulated may suggest a role of this gene in those brain areas where the differentiation is orchestrated by estradiol. The expression of BNIP2 was inhibited by estradiol. BNIP2 is implicated in the suppression of cell death and interacts with the BCL-2 and adenovirus E1B 19 kDa proteins. BNIP2 is highly expressed in patients with favorable neuroblastoma (NB) (PMID: 25611382).