BNIP3L Polyclonal antibody

• 

  WB analysis using 29848-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29848-1-AP (BNIP3L antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

BNIP3L Polyclonal Antibody for WB, ELISA

Cat No. 29848-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Adenovirus E1B19K-binding protein B5, BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A, BNIP3A, BNIP3H, NIP3L

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, mouse brain cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29848-1-AP targets BNIP3L in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31514

  Product name: Recombinant human BNIP3L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 77-146 aa of BC001559

  Sequence: DAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSS

• Full Name: BCL2/adenovirus E1B 19kDa interacting protein 3-like
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC001559
• Gene Symbol: BNIP3L
• Gene ID (NCBI): 665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60238
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BNIP3L (also known as NIX) is a mitochondrial outer-membrane protein that belongs to the BH3-only subgroup of the BCL-2 family. Initially identified as a weak pro-apoptotic factor, it has emerged as a key mitophagy receptor that bridges damaged or surplus mitochondria to the autophagosome, thereby safeguarding mitochondrial quality and cellular homeostasis.