BOLA1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BOLA1 Polyclonal antibody (18017-1-AP)

BOLA1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18017-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

bolA homolog 1 (E. coli), BolA like protein 1, BOLA1, CGI 143, hBolA, RP11 196G18.18

• 

  WB analysis using 18017-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18017-1-AP (BOLA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 18017-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18017-1-AP (BOLA1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 18017-1-AP

  IP result of anti-BOLA1 (IP:18017-1-AP, 4ug; Detection:18017-1-AP 1:800) with HepG2 cells lysate 3480ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 18017-1-AP

  Immunofluorescent analysis of HepG2 cells using 18017-1-AP (BOLA1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BOLA1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human lung tissue, human heart tissue, human kidney tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18017-1-AP targets BOLA1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12565

  Product name: Recombinant human BOLA1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-137 aa of BC063405

  Sequence: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP

• Full Name: bolA homolog 1 (E. coli)
• Calculated Molecular Weight: 137 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC063405
• Gene Symbol: BOLA1
• Gene ID (NCBI): 51027
• RRID: AB_2066933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3E2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The BOLA1 Polyclonal antibody (Cat# 18017-1-AP) has 3 citations. These appear in Gut Microbes, Biomedical Research International, and bioRxiv. The research fields span host-microbial interactions (specifically Salmonella infection and the ELMO1 sensor), mitochondrial pathway proteome profiling in mouse models, and prognostic value of BolA family member expression in human hepatocellular carcinoma. All three studies utilized the antibody for Western blot applications.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Gut Microbes; Proteome profiling indicates a link between mitochondrial pathways and the host-microbial sensor ELMO1 following Salmonella infection.; Authors - Sajan C Achi
human	WB	Biomed Res Int; Prognostic Values of BolA Family Member Expression in Hepatocellular Carcinoma; Authors - Dong Wang
mouse	WB	bioRxiv; Proteome profiling identifies a link between the mitochondrial pathways and host-microbial sensor ELMO1 following Salmonella infection; Authors - Sajan C Achi