BOLA1 Polyclonal antibody

• 

  WB analysis using 18017-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18017-1-AP (BOLA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 18017-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18017-1-AP (BOLA1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 18017-1-AP

  IP result of anti-BOLA1 (IP:18017-1-AP, 4ug; Detection:18017-1-AP 1:800) with HepG2 cells lysate 3480ug.

• 

  IHC staining of human lung using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human lung using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human heart using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human heart using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human kidney using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human spleen using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human spleen using 18017-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 18017-1-AP (BOLA1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 18017-1-AP

  Immunofluorescent analysis of HepG2 cells using 18017-1-AP (BOLA1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

BOLA1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18017-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

bolA homolog 1 (E. coli), BolA like protein 1, BOLA1, CGI 143, hBolA, RP11 196G18.18

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human lung tissue, human heart tissue, human kidney tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

18017-1-AP targets BOLA1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12565

  Product name: Recombinant human BOLA1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-137 aa of BC063405

  Sequence: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP

• Full Name: bolA homolog 1 (E. coli)
• Calculated Molecular Weight: 137 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC063405
• Gene Symbol: BOLA1
• Gene ID (NCBI): 51027
• RRID: AB_2066933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3E2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biomed Res Int; Prognostic Values of BolA Family Member Expression in Hepatocellular Carcinoma; Authors - Dong Wang
mouse	WB	bioRxiv; Proteome profiling identifies a link between the mitochondrial pathways and host-microbial sensor ELMO1 following Salmonella infection; Authors - Sajan C Achi