BOLA2 Polyclonal antibody

• 

  WB analysis of HepG2 using 26080-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26080-1-AP (BOLA2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 26080-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 26080-1-AP (BOLA2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

BOLA2 Polyclonal Antibody for WB, ELISA

Cat No. 26080-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

bolA homolog 2 (E. coli), BolA like protein 2, BOLA2, BOLA2A, BOLA2B, My016

---

Tested Applications

• Positive WB detected in: HepG2 cells, human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

26080-1-AP targets BOLA2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23260

  Product name: Recombinant human BOLA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-104 aa of BC130403

  Sequence: MASAKSLDRWKARLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVL

• Full Name: bolA homolog 2 (E. coli)
• Observed Molecular Weight: 7 kDa
• GenBank Accession Number: BC130403
• Gene Symbol: BOLA2
• Gene ID (NCBI): 552900
• RRID: AB_2880367
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3K6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Genet; Integrative analysis of the role of BOLA2B in human pan-cancer; Authors - Mingxing Liang ; KD Validated