BOP1 Polyclonal antibody

• 

  WB analysis using 28366-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28366-1-AP (BOP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 28366-1-AP

  WB result of BOP1 antibody (28366-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BOP1 transfected HeLa cells.

• 

  IHC staining of human colon cancer using 28366-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28366-1-AP (BOP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 28366-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28366-1-AP (BOP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 28366-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28366-1-AP (BOP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 28366-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28366-1-AP (BOP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-3 using 28366-1-AP

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using 28366-1-AP (BOP1 antibody) at dilution of 1:100 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

BOP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28366-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

block of proliferation 1, BOP1, KIAA0124

---

Tested Applications

• Positive WB detected in: DU 145 cells, HeLa cells, NCI-H1299 cells
• Positive IHC detected in: human colon cancer tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 1 publications below

Product Information

28366-1-AP targets BOP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26669

  Product name: Recombinant human BOP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-135 aa of BC013787

  Sequence: MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGDEYAEDSSDEEDIRNT

• Full Name: block of proliferation 1
• Calculated Molecular Weight: 84 kDa
• Observed Molecular Weight: 117 kDa
• GenBank Accession Number: BC013787
• Gene Symbol: BOP1
• Gene ID (NCBI): 23246
• RRID: AB_2881123
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14137
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Block of Proliferation 1(BOP1) protein was first isolated from a mouse, and the truncation protein may led to cell cycle arrest. Bop1 plays a role in processing of the 28S and 5.8S rRNAs (ribosomal RNAs) to regulate ribosome biogenesis. And Bop1 also act as a component of Pes1/Bop1/WDR21 (PeBoW) complex for mature 60S ribosome, and consequently acts during cell division at G1 checkpoints (PMID:18670790; PMID:26940494). What's more, abnormal expression of BOP1 was associated with liver or colorectal cancers(PMID:16804918). The molecular weight of the protein we detected was slightly higher, about 117 kd, which is also seen in the article(PMID: 30100995).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Biol Sci; Discovery of a novel HDACi structure that inhibits the proliferation of ovarian cancer cells in vivo and in vitro.; Authors - Miao Bai
human	WB	Front Oncol; Suppression of Ribosome Biogenesis by Targeting WD Repeat Domain 12 (WDR12) Inhibits Glioma Stem-Like Cell Growth.; Authors - Lanjuan Mi
human	WB,IF	J Cancer; Prognostic and Immune Landscape Analysis of Ubiquitination-related Genes in Hepatocellular Carcinoma: Based on Bulk and Single-cell RNA Sequencing Data; Authors - Zibo Yuan
	WB	Adv Sci (Weinh); Targeting BRIX1 via Engineered Exosomes Induces Nucleolar Stress to Suppress Cancer Progression; Authors - Yu Gan