BPTF Polyclonal antibody

BPTF Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 28016-1-AP

Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

FAC1, FALZ

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHCIF/ICC

IHC staining of human breast cancer using 28016-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28016-1-AP (BPTF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 28016-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28016-1-AP (BPTF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 28016-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 28016-1-AP (BPTF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 28016-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 28016-1-AP (BPTF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 28016-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28016-1-AP (BPTF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 28016-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28016-1-AP (BPTF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 28016-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28016-1-AP (BPTF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 28016-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28016-1-AP (BPTF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 28016-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28016-1-AP (BPTF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 28016-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28016-1-AP (BPTF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 28016-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using BPTF antibody (28016-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in	human breast cancer tissue, human colon cancer tissue, human liver cancer tissue, human ovary tumor tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28016-1-AP targets BPTF in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag27761 Product name: Recombinant human BPTF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 459-657 aa of NM_004459 Sequence: MEPIGYDRSRRKYWFLNRRLIIEEDTENENEKKIWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNKARGSNKSFLAAANEEILESIRAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQSLEKDSDDKTPDDDPEQGKSEEPTEVGDKGNSVSANLGDNTTNATSEETSPSEGRSP Predict reactive species
Full Name	bromodomain PHD finger transcription factor
Calculated Molecular Weight	338 kDa
GenBank Accession Number	NM_004459
Gene Symbol	BPTF
Gene ID (NCBI)	2186
RRID	AB_2918139
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q12830
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Bromodomain PHD finger transcription factor (BPTF), a histone-binding component of NURF (nucleosome-remodeling factor), plays an important role in catalyzing ATP-dependent nucleosome sliding and facilitating transcription of chromatin. It has been reported that BPTF maybe a novel and potential therapeutic target in hepatocellular carcinoma. BPTF may also regulate transcription through direct binding to DNA or transcription factors.(PMID: 30419422)

Protocols

Product Specific Protocols
IF protocol for BPTF antibody 28016-1-AP	Download protocol
IHC protocol for BPTF antibody 28016-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	IHC	Biomolecules Lumbrokinase Extracted from Earthworms Synergizes with Bevacizumab and Chemotherapeutics in Treating Non-Small Cell Lung Cancer by Targeted Inactivation of BPTF/VEGF and NF-κB/COX-2 Signaling Authors - Chunyu Hua View Article