BRAP Polyclonal antibody

• 

  WB analysis of MCF-7 using 27431-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 27431-1-AP (BRAP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 27431-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 27431-1-AP (BRAP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MCF-7 using 27431-1-AP

  IP result of anti-BRAP (IP:27431-1-AP, 4ug; Detection:27431-1-AP 1:1000) with MCF-7 cells lysate 3200 ug.

• 

  IHC staining of human lung cancer using 27431-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27431-1-AP (BRAP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 27431-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27431-1-AP (BRAP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 27431-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27431-1-AP (BRAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 27431-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27431-1-AP (BRAP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 27431-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27431-1-AP (BRAP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 27431-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27431-1-AP (BRAP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

BRAP Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 27431-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, IHC, ELISA

Synonyms

BRAP, BRAP2, BRCA1 associated protein, IMP, RING finger protein 52, RNF52

---

Tested Applications

• Positive WB detected in: MCF-7 cells, A431 cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27431-1-AP targets BRAP in WB, IP, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26728

  Product name: Recombinant human BRAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 376-535 aa of BC136698

  Sequence: RLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRD

• Full Name: BRCA1 associated protein
• Calculated Molecular Weight: 592 aa, 67 kDa
• Observed Molecular Weight: 62-70 kDa, 48 kDa
• GenBank Accession Number: BC136698
• Gene Symbol: BRAP
• Gene ID (NCBI): 8315
• RRID: AB_2880869
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z569
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.