BRAP Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of MCF-7 using 83314-6-RR (same clone as 83314-6-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using BRAP antibody (83314-6-RR, Clone: 240099D8 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 83314-6-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 83314-6-RR (same clone as 83314-6-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using BRAP antibody (83314-6-RR, Clone: 240099D8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83314-6-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83314-6-RR (same clone as 83314-6-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug BRAP Recombinant antibody (83314-6-RR, Clone:240099D8) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83314-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83314-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83314-6-RR against Human BRAP were performed. The affinity constant is 6.34 nM.

BRAP Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 83314-6-PBS

Clone No.240099D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

Renal carcinoma antigen NY-REN-63, IMP, EC:2.3.2.27, BRCA1-associated protein, BRCA1 associated protein

---

Product Information

83314-6-PBS targets BRAP in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26728

  Product name: Recombinant human BRAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 376-535 aa of BC136698

  Sequence: RLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRD

• Full Name: BRCA1 associated protein
• Calculated Molecular Weight: 592 aa, 67 kDa
• GenBank Accession Number: BC136698
• Gene Symbol: BRAP
• Gene ID (NCBI): 8315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q7Z569
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.