BRCC3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85430-4-RR (same clone as 85430-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85430-4-RR (BRCC3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85430-4-PBS in a different storage buffer formulation.

• 

  WB analysis using 85430-4-RR (same clone as 85430-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85430-4-RR (BRCC3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85430-4-PBS in a different storage buffer formulation.

• 

  IP experiment of SK-BR-3 using 85430-4-RR (same clone as 85430-4-PBS)

  IP result of anti-BRCC3 (IP:85430-4-RR, 4ug; Detection:85430-4-RR 1:2000) with SK-BR-3 cells lysate 1280 ug. This data was developed using the same antibody clone with 85430-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 85430-4-RR (same clone as 85430-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85430-4-RR (BRCC3 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85430-4-PBS in a different storage buffer formulation.

• 

  IHC staining of Human placenta using 85430-4-RR (same clone as 85430-4-PBS)

  Immunohistochemical analysis of paraffin-embedded Human placenta tissue slide using 85430-4-RR (BRCC3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85430-4-PBS in a different storage buffer formulation.

BRCC3 Uni-rAb^® Recombinant Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 85430-4-PBS

Clone No.242931B9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

BRCA1/BRCA2-containing complex subunit 3, BRCA1/BRCA2-containing complex subunit 36, BRCA1-A complex subunit BRCC36, BRCC36, BRISC complex subunit BRCC36

---

Product Information

85430-4-PBS targets BRCC3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7584

  Product name: Recombinant human BRCC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-316 aa of BC002999

  Sequence: LESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE

• Full Name: BRCA1/BRCA2-containing complex, subunit 3
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC002999
• Gene Symbol: BRCC3
• Gene ID (NCBI): 79184
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P46736
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BRCA1-BRCA2-containing complex subunit 3 (BRCC3), a Lys-63-specific deubiquitinase, is a member of the JAMM/MPN family of zinc metalloproteases. BRCC3 have been shown to promote the inflammasome activation by deubiquitinating NOD-like receptor containing pyrin domain 3 (NLRP3). BRCC3 is associated with G2/M arrest in breast cancer cells and DNA damage. The expression of BRCC3 is associated with increased cell proliferation. (PMID: 23246432, PMID: 30272359)