BRF1 Polyclonal antibody

• 

BRF1 Polyclonal Antibody for ELISA

Cat No. 12711-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

B related factor 1, BRF, BRF 1, BRF1, GTF3B, hBRF, hTFIIIB90, TAF3B2, TAF3C, TAFIII90, TF3B90, TFIIIB90

---

Product Information

12711-1-AP targets BRF1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3393

  Product name: Recombinant human BRF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-208 aa of BC016743

  Sequence: MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVVTGVYPRCLHASQWPVCAACPVRKFWSVG

• Full Name: BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae)
• Calculated Molecular Weight: 208 aa, 22 kDa
• GenBank Accession Number: BC016743
• Gene Symbol: BRF1
• Gene ID (NCBI): 2972
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92994
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.